CABS-dock: 2O2F-GPYGL

Project name: 2O2F-GPYGL

Status: done

submitted: 2025-08-25 08:32:11, status changed: 2025-08-25 10:34:50

Project settings

Protein sequence(s)	GYDNREIVMKYIHYKLSQRGYEWDEVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP input pdb
Peptide sequence	GPYGL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.5982	5.3394	22.1362	126
cluster_2.pdb ( medoid)	14.0712	5.54326	22.2595	78
cluster_3.pdb ( medoid)	12.7954	8.83133	28.7831	113
cluster_4.pdb ( medoid)	12.5333	7.5798	24.2952	95
cluster_5.pdb ( medoid)	11.933	11.816	27.5615	141
cluster_6.pdb ( medoid)	8.63631	11.1159	34.0025	96
cluster_7.pdb ( medoid)	8.51019	11.6331	36.4542	99
cluster_8.pdb ( medoid)	8.20514	13.2844	37.1885	109
cluster_9.pdb ( medoid)	5.61764	13.8848	31.3548	78
cluster_10.pdb ( medoid)	4.80355	13.5317	29.6817	65