CABS-dock: RecA-Cs5

Project name: RecA-Cs5

Status: done

submitted: 2026-01-10 14:46:35, status changed: 2026-01-10 17:59:25

Project settings

Protein sequence(s)	EGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVVIRNGDWL input pdb
Peptide sequence	QAIIHNEKVQAHGKKVL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCHHHHHCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	22.4664	7.25527	28.2596	163
cluster_2.pdb ( medoid)	20.9	5.45455	23.8663	114
cluster_3.pdb ( medoid)	20.1449	5.70864	27.0308	115
cluster_4.pdb ( medoid)	14.3021	12.0262	35.8154	172
cluster_5.pdb ( medoid)	11.2992	5.7526	16.97	65
cluster_6.pdb ( medoid)	9.86971	6.58581	14.7254	65
cluster_7.pdb ( medoid)	7.58626	10.0181	23.6071	76
cluster_8.pdb ( medoid)	6.94987	14.101	35.694	98
cluster_9.pdb ( medoid)	6.62131	11.7802	30.6192	78
cluster_10.pdb ( medoid)	4.86515	11.0993	30.9096	54