Project name: RecA-Cs5

Status: done

submitted: 2026-01-10 14:46:35, status changed: 2026-01-10 17:59:25

Project settings
Protein sequence(s) EGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVVIRNGDWL input pdb
Peptide sequence QAIIHNEKVQAHGKKVL
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCHHHHHCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 22.4664 7.25527 28.2596 163
cluster_2.pdb ( medoid) 20.9 5.45455 23.8663 114
cluster_3.pdb ( medoid) 20.1449 5.70864 27.0308 115
cluster_4.pdb ( medoid) 14.3021 12.0262 35.8154 172
cluster_5.pdb ( medoid) 11.2992 5.7526 16.97 65
cluster_6.pdb ( medoid) 9.86971 6.58581 14.7254 65
cluster_7.pdb ( medoid) 7.58626 10.0181 23.6071 76
cluster_8.pdb ( medoid) 6.94987 14.101 35.694 98
cluster_9.pdb ( medoid) 6.62131 11.7802 30.6192 78
cluster_10.pdb ( medoid) 4.86515 11.0993 30.9096 54