CABS-dock: TRCVLPSSPRLW

Project name: TRCVLPSSPRLW

Status: done

submitted: 2026-04-02 10:04:53, status changed: 2026-04-02 10:35:05

Project settings

Protein sequence(s)	MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence	TRCVLPSSPRLW
Simulation mc cycles	5
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.9859	3.85386	32.8961	104
cluster_2.pdb ( medoid)	20.2699	5.67344	37.1246	115
cluster_3.pdb ( medoid)	19.8789	5.03046	9.71599	100
cluster_4.pdb ( medoid)	16.1488	5.26355	15.2863	85
cluster_5.pdb ( medoid)	12.2723	9.77815	36.57	120
cluster_6.pdb ( medoid)	10.5965	10.2864	28.6435	109
cluster_7.pdb ( medoid)	10.0503	12.6364	23.6843	127
cluster_8.pdb ( medoid)	6.8263	10.2545	38.1212	70
cluster_9.pdb ( medoid)	5.34909	16.8253	36.6509	90
cluster_10.pdb ( medoid)	3.86698	16.5504	40.6283	64