Project name: >jg2856.t1+P27958

Status: done

submitted: 2026-02-26 07:39:13, status changed: 2026-02-26 15:24:31

Project settings
Protein sequence(s) APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMKGSVVIVGRIVLSGKPAIIPKKGSVVIVGRIVLSGKPA input pdb
Peptide sequence LVHYHSRYRRLPSL
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 18.4443 8.94587 37.0724 165
cluster_2.pdb ( medoid) 16.412 7.55546 25.9992 124
cluster_3.pdb ( medoid) 15.9699 8.64127 35.9812 138
cluster_4.pdb ( medoid) 13.3531 11.5329 33.6005 154
cluster_5.pdb ( medoid) 13.2539 8.8276 21.7799 117
cluster_6.pdb ( medoid) 10.3665 8.00655 19.2843 83
cluster_7.pdb ( medoid) 6.80517 7.20041 27.4102 49
cluster_8.pdb ( medoid) 5.8653 11.2526 29.1446 66
cluster_9.pdb ( medoid) 4.92848 15.2177 31.6122 75
cluster_10.pdb ( medoid) 2.73093 10.6191 24.7032 29