Project name: V8-Pteroicidin-alpha-redock

Status: done

submitted: 2025-06-22 12:24:43, status changed: 2025-06-22 15:47:40

Project settings
Protein sequence(s) VILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQTNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDINFA input pdb
Peptide sequence FIHHIIGGLFHVGKSIHDLIR
Simulation mc cycles50
Peptide secondary structure HHHHHHHHHHHHHHHHHHHHH
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.5836 3.80661 13.9522 105
cluster_2.pdb ( medoid) 26.735 4.30147 14.8099 115
cluster_3.pdb ( medoid) 23.7036 5.52659 24.0509 131
cluster_4.pdb ( medoid) 14.1362 5.58848 23.1114 79
cluster_5.pdb ( medoid) 14.0149 7.4207 37.0061 104
cluster_6.pdb ( medoid) 13.5864 10.2308 42.4107 139
cluster_7.pdb ( medoid) 10.2794 14.7869 37.2152 152
cluster_8.pdb ( medoid) 6.22489 9.15679 37.2214 57
cluster_9.pdb ( medoid) 5.78377 14.8692 28.5234 86
cluster_10.pdb ( medoid) 2.55674 12.5159 37.6334 32