CABS-dock: LBD_FOXO1 LxxLL pep.

Project name: LBD_FOXO1 LxxLL pep.

Status: done

submitted: 2026-07-09 06:36:04, status changed: 2026-07-09 11:13:30

Project settings

Protein sequence(s)	PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT input pdb
Peptide sequence	APGLLKELLTSDSPPHN
Simulation mc cycles	50
Peptide secondary structure psipred	CCCHHHHHHHCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	56.0633	3.31768	19.2709	186
cluster_2.pdb ( medoid)	42.3158	3.02488	5.94681	128
cluster_3.pdb ( medoid)	27.0802	4.98519	11.6706	135
cluster_4.pdb ( medoid)	23.3343	4.24268	8.59957	99
cluster_5.pdb ( medoid)	21.8662	4.25314	22.0654	93
cluster_6.pdb ( medoid)	21.1023	4.88098	12.5335	103
cluster_7.pdb ( medoid)	5.29855	17.9294	38.663	95
cluster_8.pdb ( medoid)	4.91216	18.9326	41.6306	93
cluster_9.pdb ( medoid)	4.68264	10.4642	35.0477	49
cluster_10.pdb ( medoid)	1.2263	15.4938	28.9803	19