Project name: LBD_FOXO1 LxxLL pep.

Status: done

submitted: 2026-07-09 06:36:04, status changed: 2026-07-09 11:13:30

Project settings
Protein sequence(s) PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT input pdb
Peptide sequence APGLLKELLTSDSPPHN
Simulation mc cycles50
Peptide secondary structure psipred CCCHHHHHHHCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 56.0633 3.31768 19.2709 186
cluster_2.pdb ( medoid) 42.3158 3.02488 5.94681 128
cluster_3.pdb ( medoid) 27.0802 4.98519 11.6706 135
cluster_4.pdb ( medoid) 23.3343 4.24268 8.59957 99
cluster_5.pdb ( medoid) 21.8662 4.25314 22.0654 93
cluster_6.pdb ( medoid) 21.1023 4.88098 12.5335 103
cluster_7.pdb ( medoid) 5.29855 17.9294 38.663 95
cluster_8.pdb ( medoid) 4.91216 18.9326 41.6306 93
cluster_9.pdb ( medoid) 4.68264 10.4642 35.0477 49
cluster_10.pdb ( medoid) 1.2263 15.4938 28.9803 19