CABS-dock: 896b104f77ee75c

Project name: 896b104f77ee75c

Status: done

submitted: 2025-04-22 12:14:11, status changed: 2025-04-22 18:25:15

Project settings

Protein sequence(s)	AESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG input pdb
Peptide sequence	LSGLSAAQLDLNTTS
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCHHHCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.4468	5.48129	24.1536	134
cluster_2.pdb ( medoid)	21.4831	9.30964	27.8627	200
cluster_3.pdb ( medoid)	19.948	7.82034	25.1681	156
cluster_4.pdb ( medoid)	11.8075	10.163	28.6709	120
cluster_5.pdb ( medoid)	11.1509	4.93235	18.8613	55
cluster_6.pdb ( medoid)	11.049	7.51201	14.7484	83
cluster_7.pdb ( medoid)	7.14619	9.93536	31.5642	71
cluster_8.pdb ( medoid)	5.89512	13.9098	26.0121	82
cluster_9.pdb ( medoid)	5.63125	10.6548	24.0575	60
cluster_10.pdb ( medoid)	3.36222	11.5995	23.6654	39