Project name: pep11374

Status: done

submitted: 2026-02-14 06:42:07, status changed: 2026-02-14 17:28:46

Project settings
Protein sequence(s) GFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ input pdb
Peptide sequence MNFGYPSINP
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 37.3911 2.8349 28.2534 106
cluster_2.pdb ( medoid) 34.9402 6.29647 32.3009 220
cluster_3.pdb ( medoid) 34.8568 3.27053 18.104 114
cluster_4.pdb ( medoid) 30.4395 1.97112 24.9073 60
cluster_5.pdb ( medoid) 23.6405 2.87641 12.5701 68
cluster_6.pdb ( medoid) 17.9972 7.66785 45.3412 138
cluster_7.pdb ( medoid) 10.9132 6.5975 20.3114 72
cluster_8.pdb ( medoid) 6.12634 14.0377 35.2585 86
cluster_9.pdb ( medoid) 4.98769 13.4331 38.1414 67
cluster_10.pdb ( medoid) 4.76626 14.4768 33.5071 69