CABS-dock: 89c6fad7b3e4e21

Project name: 89c6fad7b3e4e21

Status: done

submitted: 2025-12-23 15:34:37, status changed: 2025-12-23 21:24:38

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RVIFVQCGSNCFR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	35.1017	3.36166	22.9069	118
cluster_2.pdb ( medoid)	17.8278	9.42347	34.0699	168
cluster_3.pdb ( medoid)	17.4994	8.00027	26.5792	140
cluster_4.pdb ( medoid)	8.92834	15.7924	33.1688	141
cluster_5.pdb ( medoid)	6.94087	13.9752	27.505	97
cluster_6.pdb ( medoid)	6.49224	14.3248	32.1963	93
cluster_7.pdb ( medoid)	6.00485	13.8222	26.0897	83
cluster_8.pdb ( medoid)	4.31857	15.9775	36.2955	69
cluster_9.pdb ( medoid)	3.94988	11.6459	22.0631	46
cluster_10.pdb ( medoid)	3.67308	12.2513	26.2547	45