Project name: 89c6fad7b3e4e21

Status: done

submitted: 2025-12-23 15:34:37, status changed: 2025-12-23 21:24:38

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence RVIFVQCGSNCFR
Simulation mc cycles50
Peptide secondary structure psipred CEEEEECCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 35.1017 3.36166 22.9069 118
cluster_2.pdb ( medoid) 17.8278 9.42347 34.0699 168
cluster_3.pdb ( medoid) 17.4994 8.00027 26.5792 140
cluster_4.pdb ( medoid) 8.92834 15.7924 33.1688 141
cluster_5.pdb ( medoid) 6.94087 13.9752 27.505 97
cluster_6.pdb ( medoid) 6.49224 14.3248 32.1963 93
cluster_7.pdb ( medoid) 6.00485 13.8222 26.0897 83
cluster_8.pdb ( medoid) 4.31857 15.9775 36.2955 69
cluster_9.pdb ( medoid) 3.94988 11.6459 22.0631 46
cluster_10.pdb ( medoid) 3.67308 12.2513 26.2547 45