CABS-dock: GGA3

Project name: GGA3_VHS-9

Status: done

submitted: 2026-07-09 12:02:56, status changed: 2026-07-09 14:27:45

Project settings

Protein sequence(s)	ESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLI input pdb
Peptide sequence	FTIHYTG
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	47.8676	3.50968	26.6487	168
cluster_2.pdb ( medoid)	43.961	2.66145	11.2864	117
cluster_3.pdb ( medoid)	41.5324	4.04504	19.1172	168
cluster_4.pdb ( medoid)	19.6566	6.46095	24.0999	127
cluster_5.pdb ( medoid)	11.7759	7.21813	26.1053	85
cluster_6.pdb ( medoid)	9.65662	12.6338	25.8905	122
cluster_7.pdb ( medoid)	5.84663	10.4334	38.1058	61
cluster_8.pdb ( medoid)	5.11797	15.8266	34.6445	81
cluster_9.pdb ( medoid)	3.16881	13.2542	33.8784	42
cluster_10.pdb ( medoid)	2.85806	10.1468	26.597	29