CABS-dock: 8a61cc4d630cce5

Project name: 8a61cc4d630cce5

Status: done

submitted: 2026-04-19 13:47:49, status changed: 2026-04-19 16:38:57

Project settings

Protein sequence(s)	DGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENAEANRFMESVLPTLWMLKDYALQSGAGLAFE input pdb
Peptide sequence	GLLKKIKWLL
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHHHHHHC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	34.9257	3.69355	21.8861	129
cluster_2.pdb ( medoid)	23.3555	6.07993	39.8385	142
cluster_3.pdb ( medoid)	21.9324	5.10659	34.3843	112
cluster_4.pdb ( medoid)	21.1501	8.2269	31.0698	174
cluster_5.pdb ( medoid)	17.2216	4.12272	11.0356	71
cluster_6.pdb ( medoid)	16.7537	5.96883	13.1373	100
cluster_7.pdb ( medoid)	13.1651	6.53244	27.9809	86
cluster_8.pdb ( medoid)	11.4013	7.01674	20.4525	80
cluster_9.pdb ( medoid)	9.37195	5.65517	13.8145	53
cluster_10.pdb ( medoid)	8.87142	5.97424	14.0791	53