CABS-dock: 8aab05f16f993e2

Project name: 8aab05f16f993e2

Status: done

submitted: 2025-08-26 00:33:04, status changed: 2025-08-26 03:30:27

Project settings

Protein sequence(s)	SGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNSQVIGASVDSHFEHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTIKP input pdb
Peptide sequence	NDIEYNAPSEIRNHGARQLY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCHHHHHCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.4141	5.0434	30.0752	108
cluster_2.pdb ( medoid)	20.0547	5.13596	26.2455	103
cluster_3.pdb ( medoid)	17.9044	9.27148	28.6713	166
cluster_4.pdb ( medoid)	14.5949	4.93322	13.3627	72
cluster_5.pdb ( medoid)	14.3934	9.86566	27.9607	142
cluster_6.pdb ( medoid)	10.2738	7.39748	14.7078	76
cluster_7.pdb ( medoid)	7.52164	13.5609	27.3124	102
cluster_8.pdb ( medoid)	6.88472	15.9774	34.4596	110
cluster_9.pdb ( medoid)	4.73027	13.7413	26.7123	65
cluster_10.pdb ( medoid)	3.04309	18.4023	38.1364	56