CABS-dock: 8ab1cd19ea68f51

Project name: 8ab1cd19ea68f51

Status: done

submitted: 2026-01-22 13:07:01, status changed: 2026-01-22 17:09:56

Project settings

Protein sequence(s)	EASRQQQRRFNTSSIRDFEFWLSEAETLLAMKDQQARDLASSAGNLLKKHQLLERREMLAREDALKDLNTLAEDDLLSSSGTTFNVDQIVKKKDNNVNKRFLNVQELAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGVQNLLKKHKRLEGELVAHEEPAIQNVLDMAEKLKDKAAVGQEEIQLRLAQFVEHWEEKLKELAKARGLKLEESLEYLQFMQ input pdb
Peptide sequence	ATFDKNDEDSPIVMHQEDGST
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.0359	5.32272	24.09	96
cluster_2.pdb ( medoid)	15.8923	8.43176	45.9233	134
cluster_3.pdb ( medoid)	14.398	10.1403	40.0413	146
cluster_4.pdb ( medoid)	11.8165	6.17783	11.0887	73
cluster_5.pdb ( medoid)	7.28151	13.4587	39.1171	98
cluster_6.pdb ( medoid)	6.26258	12.934	38.4359	81
cluster_7.pdb ( medoid)	5.7008	12.9806	33.5834	74
cluster_8.pdb ( medoid)	5.01556	18.5423	35.4934	93
cluster_9.pdb ( medoid)	4.30367	15.8005	40.9423	68
cluster_10.pdb ( medoid)	3.15348	11.7331	35.3987	37