Project name: MHC2+RX

Status: done

submitted: 2025-12-30 09:31:02, status changed: 2025-12-30 18:19:39

Project settings
Protein sequence(s) HAIKDHVISQFGAGDAFTDGELQSVGELMLADANQDDDWFELKMMEEFRAVDQDPYFVTPSVFCNTDETCQNVAHIFIDNGEFIQPTVKVAPPESRISNSNTITLMCLVTGFFPPEISITWFKNGQELTEGSTYTTNSVDEPADLFYDCKVNHQGTYEPMGLTVEEPGVQHFVHQFMYGEGSEVFDFDSDEYFYVDKRELGRPDAWVNGEVVPAELRSIQPAEHWDRNQLLEECRAHNGTLESVRVLLDRYYWNSQKESILRTRAVTMSCRHNYEIFVPPTVKVFPKPSIEKNGNVTLICLVTGFYPKHIEVKWLLNGQELPAQVGYYVNGSELQFQDALDDICPTVEKSGLYSCRVEHSGVFEPIGLEWEH input pdb
Peptide sequence SVPEVKSDYAEALIK
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCHHHHHHHHC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 36.76 2.72035 4.42338 100
cluster_2.pdb ( medoid) 25.0877 2.39161 18.1618 60
cluster_3.pdb ( medoid) 24.9806 4.32336 26.2436 108
cluster_4.pdb ( medoid) 15.3631 12.172 61.8002 187
cluster_5.pdb ( medoid) 12.9664 12.8023 53.8347 166
cluster_6.pdb ( medoid) 9.34645 10.3783 20.915 97
cluster_7.pdb ( medoid) 7.40538 11.6132 56.6868 86
cluster_8.pdb ( medoid) 7.20631 14.5706 54.2258 105
cluster_9.pdb ( medoid) 5.73554 8.71757 25.0669 50
cluster_10.pdb ( medoid) 2.02664 20.2306 40.2557 41