CABS-dock: 8d8067e4e67a642

Project name: 8d8067e4e67a642

Status: done

submitted: 2026-01-22 12:55:06, status changed: 2026-01-22 16:57:04

Project settings

Protein sequence(s)	EASRQQQRRFNTSSIRDFEFWLSEAETLLAMKDQQARDLASSAGNLLKKHQLLERREMLAREDALKDLNTLAEDDLLSSSGTTFNVDQIVKKKDNNVNKRFLNVQELAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGVQNLLKKHKRLEGELVAHEEPAIQNVLDMAEKLKDKAAVGQEEIQLRLAQFVEHWEEKLKELAKARGLKLEESLEYLQFMQ input pdb
Peptide sequence	QADLNPHSSKDLQSQSRL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCHHHHHHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	17.5993	3.63652	15.9113	64
cluster_2.pdb ( medoid)	15.6926	6.88223	31.9331	108
cluster_3.pdb ( medoid)	13.321	5.17978	34.0354	69
cluster_4.pdb ( medoid)	11.8774	14.2287	35.0706	169
cluster_5.pdb ( medoid)	11.4603	6.80613	16.1899	78
cluster_6.pdb ( medoid)	9.48528	7.169	15.2763	68
cluster_7.pdb ( medoid)	8.80671	9.87883	22.7684	87
cluster_8.pdb ( medoid)	8.56204	10.7451	28.6132	92
cluster_9.pdb ( medoid)	6.16078	8.6028	26.8342	53
cluster_10.pdb ( medoid)	6.01689	16.9523	37.5272	102