Project name: 8de088e7550b4b

Status: done

submitted: 2025-12-29 10:20:25, status changed: 2025-12-29 13:22:45

Project settings
Protein sequence(s) MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence NPVTGRPLVNIYNCSGVQVGDNNYLTMQQT
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCEEEEECCCCCEECCCCEEEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 42.2186 2.51074 23.4725 106
cluster_2.pdb ( medoid) 30.3677 3.12833 15.7013 95
cluster_3.pdb ( medoid) 16.2318 3.81967 7.66536 62
cluster_4.pdb ( medoid) 13.8439 8.01794 28.8178 111
cluster_5.pdb ( medoid) 13.2877 10.0845 45.9703 134
cluster_6.pdb ( medoid) 11.8443 12.2422 34.9374 145
cluster_7.pdb ( medoid) 9.99541 17.7081 38.5393 177
cluster_8.pdb ( medoid) 6.60596 6.66065 13.7917 44
cluster_9.pdb ( medoid) 4.99149 14.2242 30.4369 71
cluster_10.pdb ( medoid) 4.59589 11.9672 30.2687 55