CABS-dock: WV0101(1

Project name: WV0101(1

Status: done

submitted: 2026-04-04 09:13:26, status changed: 2026-04-04 15:06:15

Project settings

Protein sequence(s)

DTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSE input pdb

Peptide sequence

WVIKEAFRINPCFDI

Simulation mc cycles

100

Peptide secondary structure psipred

CCCCCCCCCCCCCCC

Flexible regions

222:B - 31:B

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.083	6.56065	26.4103	158
cluster_2.pdb ( medoid)	17.7868	8.20835	25.6874	146
cluster_3.pdb ( medoid)	17.5425	5.70044	23.8905	100
cluster_4.pdb ( medoid)	16.4108	6.58104	26.9113	108
cluster_5.pdb ( medoid)	14.2544	9.61105	23.7756	137
cluster_6.pdb ( medoid)	10.4449	7.46777	17.3723	78
cluster_7.pdb ( medoid)	9.72601	9.15072	18.7978	89
cluster_8.pdb ( medoid)	7.5309	8.09996	19.8527	61
cluster_9.pdb ( medoid)	7.49367	10.0084	29.6318	75
cluster_10.pdb ( medoid)	4.98355	9.63169	20.3685	48