CABS-dock: seymahoca_6ycf_a_zincir

Project name: seymahoca_6ycf_a_zincir_apelin13

Status: done

submitted: 2026-02-13 18:07:15, status changed: 2026-02-14 18:25:29

Project settings

Protein sequence(s)	VPQSIDWRDYGAVTSVKNQNPCGACWAFAAIATVESIYKIKKGILEPLSEQQVLDCAKGYGCKGGWEFRAFEFIISNKGVASAGAIYPYKAAKGTCKTNDGVPNSAYITGYARVPRNNESSMMYAVSKQPITVAVDANANFQYYKSGVFNGPCGTSLNHAVTAIGYGQDSNGKKYWIVKNSWGARWGEAGYIRMARDVSSSSGICGIAIDPSLYPTLE input pdb
Peptide sequence	QRPRLSHKGPMPF
Simulation mc cycles	200
Peptide secondary structure	CCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	42.6986	4.23902	24.6476	181
cluster_2.pdb ( medoid)	21.7166	9.02534	35.9969	196
cluster_3.pdb ( medoid)	21.5241	7.15476	36.6691	154
cluster_4.pdb ( medoid)	15.4059	2.40168	5.47977	37
cluster_5.pdb ( medoid)	15.1527	4.22368	25.831	64
cluster_6.pdb ( medoid)	12.3421	11.0192	34.5596	136
cluster_7.pdb ( medoid)	12.063	11.1912	23.623	135
cluster_8.pdb ( medoid)	8.54126	5.03439	13.0622	43
cluster_9.pdb ( medoid)	6.544	5.50122	13.0081	36
cluster_10.pdb ( medoid)	1.60692	11.2016	29.679	18