Project name: seymahoca_6ycf_a_zincir_apelin13

Status: done

submitted: 2026-02-13 18:07:15, status changed: 2026-02-14 18:25:29

Project settings
Protein sequence(s) VPQSIDWRDYGAVTSVKNQNPCGACWAFAAIATVESIYKIKKGILEPLSEQQVLDCAKGYGCKGGWEFRAFEFIISNKGVASAGAIYPYKAAKGTCKTNDGVPNSAYITGYARVPRNNESSMMYAVSKQPITVAVDANANFQYYKSGVFNGPCGTSLNHAVTAIGYGQDSNGKKYWIVKNSWGARWGEAGYIRMARDVSSSSGICGIAIDPSLYPTLE input pdb
Peptide sequence QRPRLSHKGPMPF
Simulation mc cycles200
Peptide secondary structure CCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 42.6986 4.23902 24.6476 181
cluster_2.pdb ( medoid) 21.7166 9.02534 35.9969 196
cluster_3.pdb ( medoid) 21.5241 7.15476 36.6691 154
cluster_4.pdb ( medoid) 15.4059 2.40168 5.47977 37
cluster_5.pdb ( medoid) 15.1527 4.22368 25.831 64
cluster_6.pdb ( medoid) 12.3421 11.0192 34.5596 136
cluster_7.pdb ( medoid) 12.063 11.1912 23.623 135
cluster_8.pdb ( medoid) 8.54126 5.03439 13.0622 43
cluster_9.pdb ( medoid) 6.544 5.50122 13.0081 36
cluster_10.pdb ( medoid) 1.60692 11.2016 29.679 18