CABS-dock: primed p9

Project name: primed p9

Status: done

submitted: 2025-05-09 14:39:44, status changed: 2025-05-09 19:40:23

Project settings

Protein sequence(s)	TPIATFVSGSPSLNTYNATTVNSSANAFSCAYYLQQWNIQGLLVTSLYLKLDSATMGNRPGDLNSANAKWFTFWVSAYLQQCNPSGIQAGTVSPSTATLTDFEPMANRSVTSPWTYSANGYYEPSIGEFQVFSPVVTGAWNPGNIGIRVLPVPVSASGERYTLLCYSLQCTNASIFNPNNSGTMIVGPVLYSCPAASLP input pdb
Peptide sequence	WWHWEF
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	39.0435	3.27839	10.1232	128
cluster_2.pdb ( medoid)	28.8466	4.57594	30.4986	132
cluster_3.pdb ( medoid)	22.4187	6.15557	27.2676	138
cluster_4.pdb ( medoid)	17.8899	3.74514	16.2571	67
cluster_5.pdb ( medoid)	16.3983	10.2449	33.3907	168
cluster_6.pdb ( medoid)	13.8653	2.23579	8.03205	31
cluster_7.pdb ( medoid)	10.3177	8.62599	22.2645	89
cluster_8.pdb ( medoid)	10.1717	8.06156	17.0585	82
cluster_9.pdb ( medoid)	10.128	10.4661	29.3734	106
cluster_10.pdb ( medoid)	6.34384	9.30036	29.909	59