CABS-dock: RBX1

Project name: RBX1_binder7

Status: done

submitted: 2026-03-21 23:15:48, status changed: 2026-03-22 01:53:56

Project settings

Protein sequence(s)	MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH input pdb
Peptide sequence	YTDDGETLMEEALRQQELEQRDTICYRN
Simulation mc cycles	50
Peptide secondary structure psipred	CCCHHHHHHHHHHHHHHHHHHHCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.0131	5.17096	26.525	119
cluster_2.pdb ( medoid)	18.5118	6.0502	26.528	112
cluster_3.pdb ( medoid)	15.5758	12.5194	36.4679	195
cluster_4.pdb ( medoid)	9.31594	9.01681	27.5361	84
cluster_5.pdb ( medoid)	9.28961	9.15	29.2437	85
cluster_6.pdb ( medoid)	8.30177	12.5275	31.8291	104
cluster_7.pdb ( medoid)	6.18572	14.873	36.5212	92
cluster_8.pdb ( medoid)	5.59758	16.4357	29.8457	92
cluster_9.pdb ( medoid)	4.6585	13.309	26.7111	62
cluster_10.pdb ( medoid)	2.94732	18.661	31.4926	55