CABS-dock: V131I-F132Y

Project name: V131I-F132Y

Status: done

submitted: 2026-07-26 11:45:07, status changed: 2026-07-26 19:15:55

Project settings

Protein sequence(s)	GSHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWMIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM input pdb
Peptide sequence	GEEIRLKIY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.201	4.57817	13.9297	152
cluster_2.pdb ( medoid)	32.9432	3.15695	24.2199	104
cluster_3.pdb ( medoid)	32.0361	4.4325	12.6649	142
cluster_4.pdb ( medoid)	27.4667	2.91262	14.0182	80
cluster_5.pdb ( medoid)	20.7073	5.60188	26.612	116
cluster_6.pdb ( medoid)	18.7864	5.6956	31.7351	107
cluster_7.pdb ( medoid)	18.7095	5.07763	15.4251	95
cluster_8.pdb ( medoid)	15.6157	4.22651	26.8749	66
cluster_9.pdb ( medoid)	13.4762	6.75264	18.036	91
cluster_10.pdb ( medoid)	6.5716	7.15199	17.7636	47