Project name: V131I-F132Y

Status: done

submitted: 2026-07-26 11:45:07, status changed: 2026-07-26 19:15:55

Project settings
Protein sequence(s) GSHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWMIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM input pdb
Peptide sequence GEEIRLKIY
Simulation mc cycles50
Peptide secondary structure psipred CCCEEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 33.201 4.57817 13.9297 152
cluster_2.pdb ( medoid) 32.9432 3.15695 24.2199 104
cluster_3.pdb ( medoid) 32.0361 4.4325 12.6649 142
cluster_4.pdb ( medoid) 27.4667 2.91262 14.0182 80
cluster_5.pdb ( medoid) 20.7073 5.60188 26.612 116
cluster_6.pdb ( medoid) 18.7864 5.6956 31.7351 107
cluster_7.pdb ( medoid) 18.7095 5.07763 15.4251 95
cluster_8.pdb ( medoid) 15.6157 4.22651 26.8749 66
cluster_9.pdb ( medoid) 13.4762 6.75264 18.036 91
cluster_10.pdb ( medoid) 6.5716 7.15199 17.7636 47