Project name: 1C4B

Status: done

submitted: 2025-12-12 13:22:27, status changed: 2025-12-12 17:16:33

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence CYKLAEGDKYYIC
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.6487 6.48951 25.3281 134
cluster_2.pdb ( medoid) 19.504 6.1013 18.387 119
cluster_3.pdb ( medoid) 19.1245 8.20935 26.2249 157
cluster_4.pdb ( medoid) 13.3072 5.63604 18.9298 75
cluster_5.pdb ( medoid) 11.5515 5.8867 20.2324 68
cluster_6.pdb ( medoid) 10.3778 12.2376 27.1199 127
cluster_7.pdb ( medoid) 8.71058 8.72502 20.844 76
cluster_8.pdb ( medoid) 7.64568 12.6869 27.7266 97
cluster_9.pdb ( medoid) 7.46454 10.9853 21.4635 82
cluster_10.pdb ( medoid) 4.30523 15.0979 31.4516 65