CABS-dock: 8f6e10cecd246fe

Project name: 8f6e10cecd246fe

Status: done

submitted: 2026-01-22 13:16:09, status changed: 2026-01-22 22:36:46

Project settings

Protein sequence(s)	VYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRPSQPLLPQHSSLETQLFCEEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS input pdb
Peptide sequence	RTAPKRGTVSEEKKHF
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	32.2807	2.1375	12.9339	69
cluster_2.pdb ( medoid)	21.6613	4.80118	19.6139	104
cluster_3.pdb ( medoid)	21.4598	10.1585	45.1165	218
cluster_4.pdb ( medoid)	16.1869	2.53291	8.99998	41
cluster_5.pdb ( medoid)	15.2652	8.3196	36.0179	127
cluster_6.pdb ( medoid)	13.6978	10.5126	33.5432	144
cluster_7.pdb ( medoid)	9.59615	8.96192	29.3546	86
cluster_8.pdb ( medoid)	8.44724	14.4426	39.9225	122
cluster_9.pdb ( medoid)	5.43692	11.2196	25.6829	61
cluster_10.pdb ( medoid)	2.57197	10.8866	30.6059	28