CABS-dock: 9079c82b1f61bcb

Project name: 9079c82b1f61bcb

Status: done

submitted: 2026-07-29 04:55:28, status changed: 2026-07-29 06:42:48

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQLFGDNNY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.6099	5.03572	29.9054	134
cluster_2.pdb ( medoid)	17.1435	6.76641	37.6617	116
cluster_3.pdb ( medoid)	10.1113	13.5491	30.7281	137
cluster_4.pdb ( medoid)	10.0621	14.0129	43.8884	141
cluster_5.pdb ( medoid)	9.0778	10.3549	30.8906	94
cluster_6.pdb ( medoid)	8.89831	11.8	36.853	105
cluster_7.pdb ( medoid)	7.72159	8.02944	20.2873	62
cluster_8.pdb ( medoid)	6.97565	9.89156	41.2643	69
cluster_9.pdb ( medoid)	6.69232	12.4023	23.8481	83
cluster_10.pdb ( medoid)	5.06647	11.6452	26.0271	59