Project name: 9079c82b1f61bcb

Status: done

submitted: 2026-07-29 04:55:28, status changed: 2026-07-29 06:42:48

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence VQLFGDNNY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 26.6099 5.03572 29.9054 134
cluster_2.pdb ( medoid) 17.1435 6.76641 37.6617 116
cluster_3.pdb ( medoid) 10.1113 13.5491 30.7281 137
cluster_4.pdb ( medoid) 10.0621 14.0129 43.8884 141
cluster_5.pdb ( medoid) 9.0778 10.3549 30.8906 94
cluster_6.pdb ( medoid) 8.89831 11.8 36.853 105
cluster_7.pdb ( medoid) 7.72159 8.02944 20.2873 62
cluster_8.pdb ( medoid) 6.97565 9.89156 41.2643 69
cluster_9.pdb ( medoid) 6.69232 12.4023 23.8481 83
cluster_10.pdb ( medoid) 5.06647 11.6452 26.0271 59