CABS-dock: SVHRSP

Project name: SVHRSP_OLR1

Status: done

submitted: 2026-04-19 06:49:29, status changed: 2026-04-19 12:22:09

Project settings

Protein sequence(s)	SHMMPPCPQDWIWHGENCYLFSSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISSYSSSFPFWMMGLSRRNPSYPWLWEDGSPLMMPHLFRRVRRGAVSQTYPSGTCAYIQRRGAVYAENCILAAFSICQQKKANNLLRAQSHMPCPQDWIWHGEENCYLLFSSSGSFNWEKSQEKKCLSSLDAKLLKINNSTADLDFIQQAISYSSFPFWMMGLSRRRNPSYPWLWEDGSPLMMPHLFRVRGAVVSSQQTYPSGTCAYIQRGAVYAENCILAAFSICQQKKKANLRAQ input pdb
Peptide sequence	KVLNGPEEEAAAPAE
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCHHHHHCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.1237	6.15423	13.371	130
cluster_2.pdb ( medoid)	16.5305	8.3482	23.2719	138
cluster_3.pdb ( medoid)	15.9215	12.436	42.0202	198
cluster_4.pdb ( medoid)	11.6744	7.70918	23.2833	90
cluster_5.pdb ( medoid)	11.1031	9.36677	25.0655	104
cluster_6.pdb ( medoid)	10.4687	12.8956	34.3232	135
cluster_7.pdb ( medoid)	7.51461	10.9121	30.5408	82
cluster_8.pdb ( medoid)	6.17196	6.64295	20.6861	41
cluster_9.pdb ( medoid)	4.89199	7.7678	23.3396	38
cluster_10.pdb ( medoid)	3.65768	12.0295	20.9472	44