Project name: 913cce5ef3be327

Status: done

submitted: 2025-04-22 12:16:24, status changed: 2025-04-22 18:53:03

Project settings
Protein sequence(s) AESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG input pdb
Peptide sequence SVGEGGAAAENAGIN
Simulation mc cycles50
Peptide secondary structure psipred CCCCHHHHHHHCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 18.8397 7.48419 29.0864 141
cluster_2.pdb ( medoid) 16.6183 8.48462 35.5059 141
cluster_3.pdb ( medoid) 16.266 8.91428 28.3039 145
cluster_4.pdb ( medoid) 16.0011 6.62455 19.2255 106
cluster_5.pdb ( medoid) 15.6981 6.81612 31.7627 107
cluster_6.pdb ( medoid) 11.0803 10.7398 30.0301 119
cluster_7.pdb ( medoid) 6.68915 10.4647 27.5577 70
cluster_8.pdb ( medoid) 5.62618 13.686 42.4674 77
cluster_9.pdb ( medoid) 3.57223 12.8771 38.6325 46
cluster_10.pdb ( medoid) 3.49467 13.7352 40.7654 48