Project name: 251125 PD_CL2_8

Status: done

submitted: 2025-11-25 02:12:51, status changed: 2025-11-25 06:47:18

Project settings
Protein sequence(s) AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPEL input pdb
Peptide sequence WHRSYYTWNLNT
Simulation mc cycles50
Peptide secondary structure psipred CCCCEECEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 32.4002 3.27158 39.1502 106
cluster_2.pdb ( medoid) 24.5997 4.47161 40.5476 110
cluster_3.pdb ( medoid) 20.9549 6.39468 22.4118 134
cluster_4.pdb ( medoid) 20.1604 2.03369 3.33749 41
cluster_5.pdb ( medoid) 13.0491 10.7287 21.9906 140
cluster_6.pdb ( medoid) 12.8872 8.07001 36.1198 104
cluster_7.pdb ( medoid) 10.9895 6.9157 31.1212 76
cluster_8.pdb ( medoid) 6.72601 9.06927 25.5906 61
cluster_9.pdb ( medoid) 4.8001 8.12483 23.1627 39
cluster_10.pdb ( medoid) 2.07684 23.112 47.2043 48