CABS-dock: K1.1

Project name: K1.1_USP7

Status: done

submitted: 2026-01-12 16:44:46, status changed: 2026-01-12 21:39:13

Project settings

Protein sequence(s)	TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW input pdb
Peptide sequence	NEEEITTKGASAQSGTSGTSGTSGPSGP
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHCCCCCCCCCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.0659	5.50654	33.7347	116
cluster_2.pdb ( medoid)	19.8029	6.96869	24.7154	138
cluster_3.pdb ( medoid)	15.6318	7.99653	20.5882	125
cluster_4.pdb ( medoid)	14.2321	8.2911	21.7836	118
cluster_5.pdb ( medoid)	13.5374	10.5634	34.1087	143
cluster_6.pdb ( medoid)	13.1141	6.86286	23.6197	90
cluster_7.pdb ( medoid)	11.207	11.1538	34.1753	125
cluster_8.pdb ( medoid)	3.97286	10.0683	18.5875	40
cluster_9.pdb ( medoid)	3.52966	15.8655	28.8986	56
cluster_10.pdb ( medoid)	3.33061	14.712	31.1412	49