Project name: Павел

Status: done

submitted: 2026-03-23 07:44:52, status changed: 2026-03-23 12:09:43

Project settings
Protein sequence(s) RALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMSLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK input pdb
Peptide sequence QQKSLLQQLLTE
Simulation mc cycles50
Peptide secondary structure psipred CCHHHHHHHHHC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 47.6128 2.14228 5.86894 102
cluster_2.pdb ( medoid) 33.8763 6.13999 19.3046 208
cluster_3.pdb ( medoid) 32.8247 2.74184 7.97018 90
cluster_4.pdb ( medoid) 21.8004 3.3027 20.6212 72
cluster_5.pdb ( medoid) 17.6227 9.0792 37.2131 160
cluster_6.pdb ( medoid) 17.2813 8.79564 37.4391 152
cluster_7.pdb ( medoid) 13.6577 4.75921 12.5434 65
cluster_8.pdb ( medoid) 9.65344 4.35078 10.7865 42
cluster_9.pdb ( medoid) 6.37695 5.80215 23.4683 37
cluster_10.pdb ( medoid) 6.11565 11.7731 33.3426 72