CABS-dock: SWEETY83

Project name: SWEETY83

Status: done

submitted: 2025-11-12 09:51:03, status changed: 2025-11-12 16:18:31

Project settings

Protein sequence(s)	IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEFEE input pdb
Peptide sequence	VSGVVIADTGSTGVGTAA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEEECCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	84.227	1.19914	5.64092	101
cluster_2.pdb ( medoid)	27.1399	4.82685	20.7054	131
cluster_3.pdb ( medoid)	24.2927	4.11647	18.3463	100
cluster_4.pdb ( medoid)	23.3477	6.59593	17.7868	154
cluster_5.pdb ( medoid)	21.2589	4.79799	23.2906	102
cluster_6.pdb ( medoid)	13.6475	11.5039	28.6528	157
cluster_7.pdb ( medoid)	7.73673	8.40148	20.7248	65
cluster_8.pdb ( medoid)	6.92016	9.68185	21.1846	67
cluster_9.pdb ( medoid)	6.25798	10.7063	21.296	67
cluster_10.pdb ( medoid)	4.35515	12.8583	32.6855	56