CABS-dock: mimPA

Project name: mimPA

Status: done

submitted: 2026-03-09 12:13:11, status changed: 2026-03-10 05:55:37

Project settings

Protein sequence(s)	MANKAVNDFILAMNYDKKKLLTHQGESIENRFIKEGNQLPDEFVVIERKKRSLSTNTSDISVTATNDSRLYPGALLVVDETLLENNPTLLAVDRAPMTYSIDLPGLASSDSFLQVEDPSNSSVRGAVNDLLAKWHQDYGQVNNVPARMQYEKITAHSMEQLKVKFGSDFEKTGNSLDIDFNSVHSGEKQIQIVNFKQIYYTVSVDAVKNPGDVFQDTVTVEDLKQRGISAERPLVYISSVAYGRQVYLKLETTSKSDEVEAAFEALIKGVKVAPQTEWKQILDNTEVKAVILGSGARVVTGKVDMVEDLIQEGSRFTADHPGLPISYTTSFLRDNVVATFQNSTDYVETKVTAYRNGDLLLDHSGAYVAQYYITWDELSYNHQGKEVLTPKAWDRNGQDLTAHFTTSIPLKGNVRNLSVKIREATGLAWEWWRTVYEKTDLPLVRKRTISIWGTTLYPQVEDKVEND input pdb
Peptide sequence	HHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEEEEEEECCCCHHHEEEEEEECEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	37.1607	2.69101	12.1348	100
cluster_2.pdb ( medoid)	28.4978	2.35106	24.7669	67
cluster_3.pdb ( medoid)	14.6537	3.48036	21.1297	51
cluster_4.pdb ( medoid)	13.188	7.88598	23.8442	104
cluster_5.pdb ( medoid)	10.7284	7.45686	29.2004	80
cluster_6.pdb ( medoid)	8.48666	15.9073	27.9949	135
cluster_7.pdb ( medoid)	7.85901	14.5056	54.8356	114
cluster_8.pdb ( medoid)	6.47793	10.8059	27.9601	70
cluster_9.pdb ( medoid)	5.69103	9.84005	27.1787	56
cluster_10.pdb ( medoid)	5.34202	6.73903	28.313	36