Project name: 93b9368fff4740c

Status: done

submitted: 2026-01-16 17:47:46, status changed: 2026-01-17 03:52:50

Project settings
Protein sequence(s) QIITIPPPPNTKPPPTNTNPPPTNTTPPPTNTTIPTNTITKAANITKPGCPKQCGNLTVPYPFGIGLRSGCAIEPNFEISCVTNATGSQTPLIGNIQVYDISDAEMRISSTLNRRCYSSTGVLLQDDPAWMNLGSSNPYSFSSLNRFIVVGCDEAAVIAGRDFANGCPTVCMSSSQVIEGRCMGAGCCQIPIPKGLKYFNTSMQSSKLNHTAVWSFNRCGYAFLGEASKFEFKGLQDLGDLNFVEKIMDNVPIVVDWAIGNLSCVEAQKRSDYACLKNSRCVDSDTGLGGYRCNCNSGYQGNPYIGPGCQDVDECADPNANSCEQICINTPGSYNCSCPEGYTGDGRKNGRGCNAPSSNSEFPWIK input pdb
Peptide sequence IDNFKADDFGTMVRTNGGKQFDDMS
Simulation mc cycles50
Peptide secondary structure psipred CCCCCHHHHCCEEECCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 40.0612 2.52114 6.13449 101
cluster_2.pdb ( medoid) 23.247 4.55974 14.5498 106
cluster_3.pdb ( medoid) 22.9135 5.32438 24.0344 122
cluster_4.pdb ( medoid) 11.3596 7.74675 21.5141 88
cluster_5.pdb ( medoid) 11.3526 4.49235 9.08116 51
cluster_6.pdb ( medoid) 10.6476 7.41953 30.0339 79
cluster_7.pdb ( medoid) 10.4224 9.49875 19.1782 99
cluster_8.pdb ( medoid) 9.77376 9.20833 19.4517 90
cluster_9.pdb ( medoid) 9.40496 13.9288 37.8776 131
cluster_10.pdb ( medoid) 2.99303 11.0256 26.4541 33