CABS-dock: 93e1aa6b3e81992

Project name: 93e1aa6b3e81992

Status: done

submitted: 2025-12-22 06:53:20, status changed: 2025-12-22 13:46:21

Project settings

Protein sequence(s)	MHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDS input pdb
Peptide sequence	AKRYSELNTVLTPTGWV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCHHHHCCEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	45.0583	4.7716	13.2722	215
cluster_2.pdb ( medoid)	32.5409	3.84132	15.8315	125
cluster_3.pdb ( medoid)	25.7997	7.24814	27.1955	187
cluster_4.pdb ( medoid)	21.3406	2.67096	23.1055	57
cluster_5.pdb ( medoid)	19.2018	5.88488	24.892	113
cluster_6.pdb ( medoid)	11.3389	6.61442	22.0057	75
cluster_7.pdb ( medoid)	8.2651	11.0102	28.684	91
cluster_8.pdb ( medoid)	5.61127	15.3263	35.8395	86
cluster_9.pdb ( medoid)	2.38859	12.5597	21.2973	30
cluster_10.pdb ( medoid)	2.15746	9.73366	22.7392	21