CABS-dock: LVQMVSRLVSYV

Project name: LVQMVSRLVSYV

Status: done

submitted: 2026-04-02 10:07:15, status changed: 2026-04-02 10:36:58

Project settings

Protein sequence(s)	MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence	LVQMVSRLVSYV
Simulation mc cycles	5
Peptide secondary structure psipred	CHHHHHHHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	54.6872	1.99316	13.883	109
cluster_2.pdb ( medoid)	19.1422	9.45557	25.3574	181
cluster_3.pdb ( medoid)	18.7058	11.1195	28.7984	208
cluster_4.pdb ( medoid)	17.6856	9.04692	30.2509	160
cluster_5.pdb ( medoid)	11.24	3.82562	7.67307	43
cluster_6.pdb ( medoid)	10.5535	6.25384	12.7412	66
cluster_7.pdb ( medoid)	9.52064	2.73091	4.83499	26
cluster_8.pdb ( medoid)	9.49476	10.0055	20.8736	95
cluster_9.pdb ( medoid)	4.90092	14.6911	30.5907	72
cluster_10.pdb ( medoid)	4.84978	8.2478	16.9996	40