CABS-dock: 9525ff2ffa8579c

Project name: 9525ff2ffa8579c

Status: done

submitted: 2026-07-22 09:14:10, status changed: 2026-07-22 11:13:40

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQCGSNCRRVIRRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCHHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.5964	6.06584	28.8965	131
cluster_2.pdb ( medoid)	21.5016	5.44145	38.8271	117
cluster_3.pdb ( medoid)	20.4151	6.66174	32.6962	136
cluster_4.pdb ( medoid)	11.515	11.8107	31.5297	136
cluster_5.pdb ( medoid)	9.45897	7.40038	21.8251	70
cluster_6.pdb ( medoid)	8.41593	12.9516	35.0288	109
cluster_7.pdb ( medoid)	8.1296	16.1139	39.7169	131
cluster_8.pdb ( medoid)	4.69915	17.6628	37.3301	83
cluster_9.pdb ( medoid)	4.3598	12.8446	30.7033	56
cluster_10.pdb ( medoid)	2.3956	12.9404	24.5971	31