CABS-dock: 9562bef4ece06f6

Project name: 9562bef4ece06f6

Status: done

submitted: 2026-01-20 01:01:26, status changed: 2026-01-20 09:26:48

Project settings

Protein sequence(s)	SDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSMYRLPNVHGSDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSMYRLPNVH input pdb
Peptide sequence	RIRRACG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.3837	6.12617	24.261	131
cluster_2.pdb ( medoid)	19.3493	4.03116	15.6298	78
cluster_3.pdb ( medoid)	17.723	5.58595	27.6099	99
cluster_4.pdb ( medoid)	17.0326	9.51119	29.4281	162
cluster_5.pdb ( medoid)	16.8878	4.20421	21.1421	71
cluster_6.pdb ( medoid)	16.5015	8.54466	48.5953	141
cluster_7.pdb ( medoid)	9.91822	6.25112	34.9909	62
cluster_8.pdb ( medoid)	9.82125	10.4875	36.7379	103
cluster_9.pdb ( medoid)	8.12105	9.48153	32.8438	77
cluster_10.pdb ( medoid)	6.27408	12.1133	35.7011	76