CABS-dock: 95e8e0b2a6b459a

Project name: 95e8e0b2a6b459a

Status: done

submitted: 2026-07-08 08:37:15, status changed: 2026-07-08 15:25:34

Project settings

Protein sequence(s)	HKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSSFKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAAGISYRARVRAWAQAYNTTWSEWSPSTKWH input pdb
Peptide sequence	RFLKKLDRLLAG
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHHHHHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	28.8723	4.91821	17.4609	142
cluster_2.pdb ( medoid)	22.7431	9.05771	24.2341	206
cluster_3.pdb ( medoid)	20.5466	6.61909	20.8521	136
cluster_4.pdb ( medoid)	19.2264	4.0049	26.6309	77
cluster_5.pdb ( medoid)	18.3473	6.48596	27.5214	119
cluster_6.pdb ( medoid)	13.2893	4.81592	9.10839	64
cluster_7.pdb ( medoid)	11.5676	7.43455	22.0281	86
cluster_8.pdb ( medoid)	5.44517	10.6516	20.8666	58
cluster_9.pdb ( medoid)	5.30274	10.7492	27.1502	57
cluster_10.pdb ( medoid)	4.84871	11.3432	26.5338	55