Project name: 95e8e0b2a6b459a

Status: done

submitted: 2026-07-08 08:37:15, status changed: 2026-07-08 15:25:34

Project settings
Protein sequence(s) HKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSSFKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAAGISYRARVRAWAQAYNTTWSEWSPSTKWH input pdb
Peptide sequence RFLKKLDRLLAG
Simulation mc cycles50
Peptide secondary structure psipred CHHHHHHHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.8723 4.91821 17.4609 142
cluster_2.pdb ( medoid) 22.7431 9.05771 24.2341 206
cluster_3.pdb ( medoid) 20.5466 6.61909 20.8521 136
cluster_4.pdb ( medoid) 19.2264 4.0049 26.6309 77
cluster_5.pdb ( medoid) 18.3473 6.48596 27.5214 119
cluster_6.pdb ( medoid) 13.2893 4.81592 9.10839 64
cluster_7.pdb ( medoid) 11.5676 7.43455 22.0281 86
cluster_8.pdb ( medoid) 5.44517 10.6516 20.8666 58
cluster_9.pdb ( medoid) 5.30274 10.7492 27.1502 57
cluster_10.pdb ( medoid) 4.84871 11.3432 26.5338 55