CABS-dock: 965bdb72a1ea3

Project name: 965bdb72a1ea3

Status: done

submitted: 2026-03-15 13:52:57, status changed: 2026-03-16 04:05:27

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	IKIWFQNRRMKWGGVQVFGSNTY
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEECCCCCCCCEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	71.8239	1.42014	21.4929	102
cluster_2.pdb ( medoid)	21.3647	4.91465	39.2091	105
cluster_3.pdb ( medoid)	16.9796	7.71514	37.8469	131
cluster_4.pdb ( medoid)	14.7511	7.72826	31.5679	114
cluster_5.pdb ( medoid)	10.7436	11.0764	33.0261	119
cluster_6.pdb ( medoid)	8.44754	12.6664	27.7115	107
cluster_7.pdb ( medoid)	6.67919	13.325	34.9199	89
cluster_8.pdb ( medoid)	6.16366	14.115	35.9569	87
cluster_9.pdb ( medoid)	5.82503	12.3605	27.065	72
cluster_10.pdb ( medoid)	3.04	24.3421	44.6343	74