Project name: 965bdb72a1ea3

Status: done

submitted: 2026-03-15 13:52:57, status changed: 2026-03-16 04:05:27

Project settings
Protein sequence(s) VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence IKIWFQNRRMKWGGVQVFGSNTY
Simulation mc cycles50
Peptide secondary structure psipred CCEEEECCCCCCCCEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 71.8239 1.42014 21.4929 102
cluster_2.pdb ( medoid) 21.3647 4.91465 39.2091 105
cluster_3.pdb ( medoid) 16.9796 7.71514 37.8469 131
cluster_4.pdb ( medoid) 14.7511 7.72826 31.5679 114
cluster_5.pdb ( medoid) 10.7436 11.0764 33.0261 119
cluster_6.pdb ( medoid) 8.44754 12.6664 27.7115 107
cluster_7.pdb ( medoid) 6.67919 13.325 34.9199 89
cluster_8.pdb ( medoid) 6.16366 14.115 35.9569 87
cluster_9.pdb ( medoid) 5.82503 12.3605 27.065 72
cluster_10.pdb ( medoid) 3.04 24.3421 44.6343 74