CABS-dock: CD163 + F

Project name: CD163 + F

Status: done

submitted: 2026-05-09 02:40:51, status changed: 2026-05-09 10:00:36

Project settings

Protein sequence(s)	GSDLEMGLVNGGNRCLGRIEVKFQGRWGTVCDDNFNINHASVVCKQLECGSAVSFSGSANFGEGSGPIWFDDLVCNGNESALWNCKHEGWGKHNCDHAEDAGVICLNGADLKLRVVDGVTECSGRLEVKFQGEWGTICDDGWDSDDAAVACKQLGCPTAVTAIGRVNASEGTGHIWLDSVSCHGHESALWQCRHHEWGKHYCNHDEDAGVTCSDGSDLELRLKGGGSHCAGTVEVEIQKLVGKVCDRSWGLKEADVVCRQLGCGSALKTSYQVYSKTKATNTWLFVSSCNGNETSLWDCKNWQWGGLSCDHYDEAKITCSA input pdb
Peptide sequence	EKMEKTKVRTRENLEKT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCHHHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	25.378	5.20135	18.0088	132
cluster_2.pdb ( medoid)	22.5219	5.15053	19.5189	116
cluster_3.pdb ( medoid)	17.5378	7.69767	32.9001	135
cluster_4.pdb ( medoid)	13.6405	10.7767	37.7355	147
cluster_5.pdb ( medoid)	12.1372	7.99193	34.3631	97
cluster_6.pdb ( medoid)	10.6609	9.66146	31.6083	103
cluster_7.pdb ( medoid)	9.64148	11.9276	34.7949	115
cluster_8.pdb ( medoid)	7.61235	9.19559	32.0037	70
cluster_9.pdb ( medoid)	4.45509	7.18279	11.5572	32
cluster_10.pdb ( medoid)	4.44535	11.9226	24.5036	53