CABS-dock: 2O2F-PGLPFHP

Project name: 2O2F-PGLPFHP

Status: done

submitted: 2025-08-25 08:33:02, status changed: 2025-08-25 10:43:41

Project settings

Protein sequence(s)	GYDNREIVMKYIHYKLSQRGYEWDEVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP input pdb
Peptide sequence	PGLPFHP
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.4997	5.09441	20.035	135
cluster_2.pdb ( medoid)	22.3836	5.09302	20.2635	114
cluster_3.pdb ( medoid)	17.607	6.3611	28.5479	112
cluster_4.pdb ( medoid)	13.7289	8.52215	31.4897	117
cluster_5.pdb ( medoid)	11.1503	10.5827	33.07	118
cluster_6.pdb ( medoid)	10.9771	12.1162	39.6992	133
cluster_7.pdb ( medoid)	9.56996	9.8224	29.7648	94
cluster_8.pdb ( medoid)	5.70901	14.5384	34.1702	83
cluster_9.pdb ( medoid)	4.09328	15.6354	35.0234	64
cluster_10.pdb ( medoid)	2.22852	13.4619	28.9442	30