CABS-dock: 96946dc5afcccc3

Project name: 96946dc5afcccc3

Status: done

submitted: 2026-03-13 10:28:12, status changed: 2026-03-13 13:14:27

Project settings

Protein sequence(s)	MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence	RRMKWKKVQLFGSNDA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	25.7318	5.20757	14.5887	134
cluster_2.pdb ( medoid)	22.7943	5.61544	22.456	128
cluster_3.pdb ( medoid)	15.0313	3.65904	11.0243	55
cluster_4.pdb ( medoid)	13.8555	10.6817	27.4273	148
cluster_5.pdb ( medoid)	11.3263	11.7426	26.3531	133
cluster_6.pdb ( medoid)	10.6829	13.0114	25.7087	139
cluster_7.pdb ( medoid)	8.65531	12.94	23.9432	112
cluster_8.pdb ( medoid)	7.69071	7.28152	27.3822	56
cluster_9.pdb ( medoid)	6.42466	7.00426	13.1279	45
cluster_10.pdb ( medoid)	5.00577	9.98847	21.5527	50