Project name: tead4

Status: job pending waiting for computational server response

submitted: 2025-12-14 12:06:14, status changed: 2025-12-14 12:06:14

Project settings
Protein sequence(s) RSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE input pdb
Peptide sequence ELDLETLAPYIPMDG
Simulation mc cycles100
Peptide secondary structure CCCHHHCCCCCCCCC
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue