CABS-dock: Docking project

Project name: Docking project

Status: done

submitted: 2026-07-10 07:36:58, status changed: 2026-07-10 18:58:47

Project settings

Protein sequence(s)

MAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKNGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN input pdb

Peptide sequence

SFGDGFADF

Simulation mc cycles

Peptide secondary structure

CCCCHHHHC

Flexible regions

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	35.3842	3.25004	32.9126	115
cluster_2.pdb ( medoid)	26.8649	4.13178	25.0876	111
cluster_3.pdb ( medoid)	20.9502	4.91642	9.24093	103
cluster_4.pdb ( medoid)	19.6078	9.07803	28.1649	178
cluster_5.pdb ( medoid)	17.2891	5.14776	33.0531	89
cluster_6.pdb ( medoid)	13.3795	7.2499	16.8567	97
cluster_7.pdb ( medoid)	12.9573	8.87529	32.1864	115
cluster_8.pdb ( medoid)	10.8207	10.1657	43.8936	110
cluster_9.pdb ( medoid)	4.3053	5.10998	16.9426	22
cluster_10.pdb ( medoid)	1.7842	20.7375	42.9628	37