Project name: C-H-246_3

Status: done

submitted: 2025-02-05 06:52:28, status changed: 2025-02-05 21:02:37

Project settings
Protein sequence(s) MNMNVLVLCFVLSVSAEGLHVDRQVTGCSDHDGEEVYNLDGEEMWFADFIKREGVEPQPPFIDHITYQDGTYQTAEANQQTCKSNLDVVRTAMKDFKIEDEPPSSPMIYTRDAVELGGENTLICHVTGFYPAPVHVYWTKNGVDVTEGTSLNVPYPNTDGSFRQTARLKFIAQQGDVYSCTVSHLALDQSLTKIWDVDVQQPSVGPAVFCGVGLSVGLLGVAAGTFFLIKGNECSMASFILSFSLFFITVCTANGFRYYVVNSCEFNSSKLNDIEFTESYYYNKLEYIRFSSSVGKFVGYTEHGIKNAERWNNGPEVISSRGEKERYCLNNVGVDVESALTNTQTLRQASLCGAPSWQTCMLVCSVFDFYPKRIKVSWQRDGQEVTSDVTSTDELADGDWYYQIHSHLEYMPKSGEKISCVVEHASLSKPLITDWDPSMPESERNKIAIGTSGLILGLTLSLAGFIYYKRKAQGRILVPTN input pdb
Peptide sequence KAQDYQAALAEKDAI
Simulation mc cycles50
Peptide secondary structure psipred CHHHHHHHHHHHHCC
Flexible regions
108:B - 18:B 100:A - 19:A
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 38.5881 5.2866 23.7716 204
cluster_2.pdb ( medoid) 22.5004 2.66662 30.0249 60
cluster_3.pdb ( medoid) 19.0763 7.54863 46.8026 144
cluster_4.pdb ( medoid) 12.6137 9.90984 43.9267 125
cluster_5.pdb ( medoid) 11.5779 6.9097 20.4363 80
cluster_6.pdb ( medoid) 7.44485 5.23852 13.3984 39
cluster_7.pdb ( medoid) 7.39077 13.801 46.4091 102
cluster_8.pdb ( medoid) 4.13921 13.2875 46.1226 55
cluster_9.pdb ( medoid) 3.99501 18.2728 44.4461 73
cluster_10.pdb ( medoid) 3.0086 18.9457 55.9089 57