CABS-dock: 97ccb03d0d29abf

Project name: 97ccb03d0d29abf

Status: done

submitted: 2026-06-23 11:25:34, status changed: 2026-06-23 15:29:21

Project settings

Protein sequence(s)	VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN input pdb
Peptide sequence	AVQTNQNNELFCGK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.9417	2.62214	17.0544	89
cluster_2.pdb ( medoid)	25.0578	3.15272	32.9276	79
cluster_3.pdb ( medoid)	16.3294	11.3293	32.2341	185
cluster_4.pdb ( medoid)	12.875	7.84468	22.061	101
cluster_5.pdb ( medoid)	11.0914	8.83567	22.5793	98
cluster_6.pdb ( medoid)	11.0084	11.1733	27.9589	123
cluster_7.pdb ( medoid)	9.85929	10.0413	26.095	99
cluster_8.pdb ( medoid)	7.97837	10.4031	30.9168	83
cluster_9.pdb ( medoid)	7.93471	12.6029	29.4333	100
cluster_10.pdb ( medoid)	3.70064	11.6196	28.2168	43