Project name: Trail_53_to_63_

Status: done

submitted: 2025-12-26 17:32:42, status changed: 2025-12-26 22:10:27

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence YSTHWNDLLFCLRC
Simulation mc cycles100
Peptide secondary structure psipred CCCCCCCEEEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.0851 3.06212 13.4696 86
cluster_2.pdb ( medoid) 20.4429 4.30466 16.3809 88
cluster_3.pdb ( medoid) 14.7413 10.2433 30.7064 151
cluster_4.pdb ( medoid) 13.8107 6.80632 20.3846 94
cluster_5.pdb ( medoid) 13.3827 5.15591 13.8839 69
cluster_6.pdb ( medoid) 12.628 5.46403 13.248 69
cluster_7.pdb ( medoid) 12.4068 12.8155 31.9793 159
cluster_8.pdb ( medoid) 6.92904 15.5866 37.6142 108
cluster_9.pdb ( medoid) 6.36127 16.5061 35.0349 105
cluster_10.pdb ( medoid) 5.32312 13.338 28.4818 71