Project name: 98565e25dae9bb1

Status: done

submitted: 2026-03-13 06:23:18, status changed: 2026-03-13 12:44:19

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence RVQLFGSNDAR
Simulation mc cycles50
Peptide secondary structure psipred CCEECCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.1067 8.6041 43.3083 173
cluster_2.pdb ( medoid) 19.5177 6.14825 55.5495 120
cluster_3.pdb ( medoid) 16.3962 5.73303 18.6344 94
cluster_4.pdb ( medoid) 10.9072 12.9272 44.5452 141
cluster_5.pdb ( medoid) 8.85946 11.7389 46.5194 104
cluster_6.pdb ( medoid) 7.4193 14.1523 37.4245 105
cluster_7.pdb ( medoid) 5.91934 17.2317 53.2733 102
cluster_8.pdb ( medoid) 5.48325 4.92408 16.3115 27
cluster_9.pdb ( medoid) 4.57447 23.8279 64.3862 109
cluster_10.pdb ( medoid) 3.75009 6.66651 13.1788 25