CABS-dock: 98565e25dae9bb1

Project name: 98565e25dae9bb1

Status: done

submitted: 2026-03-13 06:23:18, status changed: 2026-03-13 12:44:19

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RVQLFGSNDAR
Simulation mc cycles	50
Peptide secondary structure psipred	CCEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.1067	8.6041	43.3083	173
cluster_2.pdb ( medoid)	19.5177	6.14825	55.5495	120
cluster_3.pdb ( medoid)	16.3962	5.73303	18.6344	94
cluster_4.pdb ( medoid)	10.9072	12.9272	44.5452	141
cluster_5.pdb ( medoid)	8.85946	11.7389	46.5194	104
cluster_6.pdb ( medoid)	7.4193	14.1523	37.4245	105
cluster_7.pdb ( medoid)	5.91934	17.2317	53.2733	102
cluster_8.pdb ( medoid)	5.48325	4.92408	16.3115	27
cluster_9.pdb ( medoid)	4.57447	23.8279	64.3862	109
cluster_10.pdb ( medoid)	3.75009	6.66651	13.1788	25