Project name: C-H-22_5

Status: done

submitted: 2025-02-04 08:23:59, status changed: 2025-02-05 02:35:05

Project settings
Protein sequence(s) MNMNVLVLCFVLSVSAEGLHVDRQVTGCSDHDGEQAYNLDGEELWFADFIKKEGVEPQPPFVDHMTYRDGTYQQAEANQQACKTSLDVLRTAMKDFKIEDEPPSSPMIYTRDAVELGGENTLICHVTGFYPAPVHVYWTKNGVDVTEGTSLNVPYPNTDGSFRQTARLKFIAQQGDVYSCTVSHLALDQSLTKIWDVDVQQPSVGPAVFCGVGLSVGLLGVAAGTFFLIKGNECSMASFILSFSLFFITVCTANGFRYYVVNSCEFNSSKLNDIEFTESYYYNKLEYIRFSSSVGKFVGYTEHGIKNAERWNNGPEVISSRGEKERYCLNNVGVDVESALTNTQTLRQASLCGAPSWQTCMLVCSVFDFYPKRIKVSWQRDGQEVTSDVTSTDELADGDWYYQIHSHLEYMPKSGEKISCVVEHASLSKPLITDWDPSMPESERNKIAIGTSGLILGLTLSLAGFIYYKRKAQGRILVPTN input pdb
Peptide sequence GTEWIKTDLGDLIQV
Simulation mc cycles50
Peptide secondary structure psipred CCCCEECCHHHHCCC
Flexible regions
108:B - 18:B 100:A - 19:A
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 34.3222 3.438 14.0218 118
cluster_2.pdb ( medoid) 32.5012 5.50749 13.0319 179
cluster_3.pdb ( medoid) 23.5298 4.46242 14.4276 105
cluster_4.pdb ( medoid) 21.8208 4.72026 13.7287 103
cluster_5.pdb ( medoid) 19.3979 5.72228 37.768 111
cluster_6.pdb ( medoid) 19.1894 5.21122 10.2788 100
cluster_7.pdb ( medoid) 14.2008 7.25309 16.8654 103
cluster_8.pdb ( medoid) 11.7921 6.44498 14.183 76
cluster_9.pdb ( medoid) 9.53042 7.76461 17.6508 74
cluster_10.pdb ( medoid) 7.47804 4.14547 8.5867 31