Project name: 98cafce32b4bae2

Status: done

submitted: 2026-04-03 07:23:53, status changed: 2026-04-03 15:37:34

Project settings
Protein sequence(s) GPQPFDEVYQGRRIEGRATGYGVFIDGMELHVMQNVDGSWISVVSHYDPVATPRAAARAAVVELQGAPLVPFTVRKNQATLTADEKRRFVDALVALKRSGRYDEFVTTHNAFIMGDTDSGERTGHRSPSFLPWHRRFLIEFEQALQAVDPSVALPYWDWSTDRTARASLWAPDFLGGSGRSLDGRVMDGPFAASTGNWPVNVRVDSRTYLRRTLGGGGRELPTRAEVDSVLAMSTYDMAPWNSASDGFRNHLEGWRGVNLHNRVHVWVGGQMATGVSPNDPVFWLHHAYIDRLWAQWQSRHPGSGYVPTGGTPNVVDLNETMKPWNDVRPADLLDHTAHYTFDTV input pdb
Peptide sequence EARHSGYLPYQMF
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.7142 9.15065 48.6786 217
cluster_2.pdb ( medoid) 13.2055 11.2075 51.6052 148
cluster_3.pdb ( medoid) 12.9151 7.89771 35.8769 102
cluster_4.pdb ( medoid) 12.8776 10.328 35.3516 133
cluster_5.pdb ( medoid) 12.6968 4.33181 18.4382 55
cluster_6.pdb ( medoid) 11.2849 14.5327 44.0652 164
cluster_7.pdb ( medoid) 5.96639 11.7324 33.4935 70
cluster_8.pdb ( medoid) 5.24955 6.28625 23.3543 33
cluster_9.pdb ( medoid) 3.23331 13.9176 36.2806 45
cluster_10.pdb ( medoid) 2.59921 12.6962 40.8078 33