CABS-dock: 98cafce32b4bae2

Project name: 98cafce32b4bae2

Status: done

submitted: 2026-04-03 07:23:53, status changed: 2026-04-03 15:37:34

Project settings

Protein sequence(s)	GPQPFDEVYQGRRIEGRATGYGVFIDGMELHVMQNVDGSWISVVSHYDPVATPRAAARAAVVELQGAPLVPFTVRKNQATLTADEKRRFVDALVALKRSGRYDEFVTTHNAFIMGDTDSGERTGHRSPSFLPWHRRFLIEFEQALQAVDPSVALPYWDWSTDRTARASLWAPDFLGGSGRSLDGRVMDGPFAASTGNWPVNVRVDSRTYLRRTLGGGGRELPTRAEVDSVLAMSTYDMAPWNSASDGFRNHLEGWRGVNLHNRVHVWVGGQMATGVSPNDPVFWLHHAYIDRLWAQWQSRHPGSGYVPTGGTPNVVDLNETMKPWNDVRPADLLDHTAHYTFDTV input pdb
Peptide sequence	EARHSGYLPYQMF
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.7142	9.15065	48.6786	217
cluster_2.pdb ( medoid)	13.2055	11.2075	51.6052	148
cluster_3.pdb ( medoid)	12.9151	7.89771	35.8769	102
cluster_4.pdb ( medoid)	12.8776	10.328	35.3516	133
cluster_5.pdb ( medoid)	12.6968	4.33181	18.4382	55
cluster_6.pdb ( medoid)	11.2849	14.5327	44.0652	164
cluster_7.pdb ( medoid)	5.96639	11.7324	33.4935	70
cluster_8.pdb ( medoid)	5.24955	6.28625	23.3543	33
cluster_9.pdb ( medoid)	3.23331	13.9176	36.2806	45
cluster_10.pdb ( medoid)	2.59921	12.6962	40.8078	33