CABS-dock: seymahoca_6yce_raw_rcsb_azincir

Project name: seymahoca_6yce_raw_rcsb_azincir_apelin13

Status: done

submitted: 2026-02-13 18:15:25, status changed: 2026-02-14 19:24:53

Project settings

Protein sequence(s)	VPQSIDWRDYGAVTSVKNQNPCGAWAFAAIATVESIYKIKKGILEPLSEQQVLDCAKGYGCKGGWEFRAFEFIISNKGVASAGAIYPYKAAKGTCKTNDGVPNSAYITGYARVPRNNESSMMYAVSKQPITVAVDANANFQYYKSGVFNGPCGTSLNHAVTAIGYGQDSNGKKYWIVKNSWGARWGEAGYIRMARDVSSSSGICGIAIDPSLYPTLE input pdb
Peptide sequence	QRPRLSHKGPMPF
Simulation mc cycles	200
Peptide secondary structure	CCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.3597	5.51906	24.563	151
cluster_2.pdb ( medoid)	23.4217	6.14815	20.2703	144
cluster_3.pdb ( medoid)	14.9426	11.1761	31.0195	167
cluster_4.pdb ( medoid)	14.4274	7.2085	35.0366	104
cluster_5.pdb ( medoid)	12.8634	9.95069	37.7013	128
cluster_6.pdb ( medoid)	11.3545	12.7702	37.7465	145
cluster_7.pdb ( medoid)	5.74526	8.70282	18.76	50
cluster_8.pdb ( medoid)	4.61604	14.7312	30.8727	68
cluster_9.pdb ( medoid)	3.60437	6.10371	11.214	22
cluster_10.pdb ( medoid)	2.11983	9.90647	17.2344	21